SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7Y925 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G7Y925
Domain Number 1 Region: 1-231
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.72e-49
Family Capz alpha-1 subunit 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G7Y925
Sequence length 325
Comment (tr|G7Y925|G7Y925_CLOSI) Capping protein (Actin filament) muscle Z-line alpha {ECO:0000313|EMBL:GAA49460.1} KW=Complete proteome; Reference proteome OX=79923 OS=Clonorchis sinensis (Chinese liver fluke). GN=CLF_103091 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Clonorchis.
Sequence
VRVISGDHPTTQKKLAAATAQYNRDQMIPVKLPNAEYSSLITAHGDLGNGQFLCPRSHST
FHYDHLKQTASDVRCLDPNDADGGDTTAEPWRHALEVAITEYTLEHFPSGSVAVYAPAVT
NEDRRLVACIVSQFRKHQSTGRWRSEWTIKIPDEPIGGTFSVHGVIKVQTHLYEEGNVQL
ISSKEVDFSVTAPNAKAFATECVRHIKNAEIAYQLPLGRFVLPPHHPHFRATEGELECIG
APLLLRMLVALSDSGNHEHLTRRGLMAKQKESHVGPSWKANSTDGTQTFCNILHSILSCR
IPSTSRFPTLRIGHRNNTLIGMRNT
Download sequence
Identical sequences G7Y925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]