SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G7YKG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G7YKG5
Domain Number - Region: 11-61
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0161
Family Hjc-like 0.015
Further Details:      
 
Domain Number - Region: 106-175
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0732
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G7YKG5
Sequence length 186
Comment (tr|G7YKG5|G7YKG5_CLOSI) Retrovirus-related Pol polyprotein from type-1 retrotransposable element R2 {ECO:0000313|EMBL:GAA53447.1} KW=Complete proteome; Reference proteome OX=79923 OS=Clonorchis sinensis (Chinese liver fluke). GN=CLF_110245 OC=Opisthorchiida; Opisthorchiata; Opisthorchiidae; Clonorchis.
Sequence
MHGARYARHNRVERGLIKRLRCLGYTVFEELRAATSTSFSKPDLIAVLERRATVIDVSMV
SDGGRVTVWNEKKQKYGADEYSLAISEIRAIVCDVDFLVHQPLIISYRGICFPQPAKAFI
GLGLPKVTVSDFCLFAIFGCPLTYDTFMRGTWRRVFIHAIDSHLTQYDGHFVLDVRILTM
LVLTES
Download sequence
Identical sequences G7YKG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]