SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8BCB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8BCB0
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.94e-57
Family Capz alpha-1 subunit 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8BCB0
Sequence length 269
Comment (tr|G8BCB0|G8BCB0_CANPC) Uncharacterized protein {ECO:0000313|EMBL:CCE41775.1} KW=Complete proteome; Reference proteome OX=578454 OS=parapsilosis). GN=CPAR2_803250 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSVKFEELVTSLIQSAPSSELPQVISSLKTISGASKSTIDDAISEYIKSQPIVISDYIIS
SLNKDLHSSKFIDHIKQEKFTFDISKQEIIDVESYTPDVSVDSSLVDKLQQYGEDNFQDY
TFTIIPESEKVYTVVIIGEKLNQDNFYTGKWHSQYAVNNGQITGSINLDIHYFEDGNVRL
KYNESGVSSSSVGDGGGEISGSVSNASDVVNFINQADNAIELKLINQFQHLNQQSFKNLR
RLLPVTRSKINWGSAIGNYRLGSDVVNKK
Download sequence
Identical sequences G8BCB0
CPAG_02669.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]