SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8BDF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G8BDF9
Domain Number - Region: 58-101
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00942
Family Capz alpha-1 subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8BDF9
Sequence length 110
Comment (tr|G8BDF9|G8BDF9_CANPC) Uncharacterized protein {ECO:0000313|EMBL:CCE43306.1} KW=Complete proteome; Reference proteome OX=578454 OS=parapsilosis). GN=CPAR2_209510 OC=Candida/Lodderomyces clade; Candida.
Sequence
MPVPFEGLIPYAIMTAFYGLAGHGVQYIRYWDNGWKNDRYFLDQWDHKMMQRDFYLTGTH
RGQTSEPIAPESFKTIEQIEQRYYTPYRNQFFSLRDRLFRGYVFGDWNFS
Download sequence
Identical sequences G8BDF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]