SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8BQN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8BQN9
Domain Number 1 Region: 3-257
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-68
Family Capz alpha-1 subunit 0.0000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8BQN9
Sequence length 265
Comment (tr|G8BQN9|G8BQN9_TETPH) Uncharacterized protein {ECO:0000313|EMBL:CCE62551.1} KW=Complete proteome; Reference proteome OX=1071381 OS=NRRL Y-8282 / UCD 70-5) (Yeast) (Fabospora phaffii). GN=TPHA_0C04010 OC=Tetrapisispora.
Sequence
MASQFDSVIADIISDAPSGEITEIYEDLIKIVGESAKESILEAIEQYNIRNCIPIEVEGK
QIIISEYNKDGVKFIDPITAISFSVDHLNRTGFDIGSSDISLSSVQEEIVKNLNEYTASD
FSGEVTFGVYPIPNEEDKTSIIISSTKYNASNFWNGEWKSKYIFDSSSNSLEGEIDVDVH
FYEDGNVSFKSNKKINLSSVNDAVSALKEVEVEFEKELDSSFSDLNEKQFKSLRRKLPIT
RSKVNWGKAIGNYRLGKDAAQGITN
Download sequence
Identical sequences G8BQN9
XP_003684985.1.77742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]