SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8DE76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G8DE76
Domain Number - Region: 69-169
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00392
Family Capz beta-1 subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G8DE76
Sequence length 231
Comment (tr|G8DE76|G8DE76_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:AET73796.1} OX=755274 OS=Phaeocystis globosa virus 14T. GN=PGBG_00088 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MERNLYNINYNSKNSSHSVYSKFVICALPRKDLIKFDILSPYMSDLNTINEIAKMRIFEI
YDTKTTEAWFKDLPKISTNEELQFVIPIDPKSGLIMSSYNENLSTYESYWLNLYNKSKRE
FKSTLNEKLNNIFGVFDVIVPKSIYVKLHYWSMGVAAWKKNVDSKYISHKIINLMPNFYI
CGENYSNYQAWCEGALQTSEEVGNRISCILDNLKRNKTKKVLKKQKNIIYT
Download sequence
Identical sequences G8DE76

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]