SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8DHL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8DHL5
Domain Number 1 Region: 1-298,396-432
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.37e-23
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  G8DHL5
Domain Number - Region: 295-395
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0188
Family Capz beta-1 subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8DHL5
Sequence length 462
Comment (tr|G8DHL5|G8DHL5_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:AET72975.1} OX=755273 OS=Phaeocystis globosa virus 12T. GN=PGAG_00086 OC=Viruses; dsDNA viruses, no RNA stage; unclassified dsDNA viruses.
Sequence
MKNYDIIIIGGGISGIYTMYNLKKKYPTLKVLLLEKDDRFGGRIYTYFEKINNQTYKMDL
GAGRLGFHHKRIMNLLEDLKLKNEIIPITNTENYIEYDKKTNIATDKSAEKRGIVDLLYK
FFNSSKISNLTHKFLKKLNLMELFSKFFTREMCKTIENSFEYKCKLKYFNADDAVYYFKH
DYNKYSKFFVLKNGLQGLIDGMLNKIKTNKNYVFKKNQNVKKINYDMERNLYNINYNSKN
SSHSVYSKFVICALPRKDLIKFDILSPYMSDLNTINEIAKMRIFEIYDTKTTEAWFKDLP
KISTNEELQFVIPIDPKSGLIMSSYNENLSTYESYWLNLYNKSKREFKSTLNEKLNNIFG
VFDVIVPKSIYVKLHYWSMGVAAWKKNVDSKYISHKIINLMPNFYICGENYSNYQAWCEG
ALQTSEEVGNRISCILDNLKRNKTKKVLKKQKKYNLYLTATH
Download sequence
Identical sequences G8DHL5 R4THQ7
gi|508181926|ref|YP_008052445.1| YP_008052445.1.98695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]