SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8UTB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8UTB9
Domain Number 1 Region: 26-96,235-397
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.15e-32
Family Lysophospholipase 0.066
Further Details:      
 
Weak hits

Sequence:  G8UTB9
Domain Number - Region: 165-219
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0654
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G8UTB9
Sequence length 598
Comment (tr|G8UTB9|G8UTB9_LEGPN) Uncharacterized protein {ECO:0000313|EMBL:AEW51475.1} KW=Complete proteome OX=933093 OS=Legionella pneumophila subsp. pneumophila ATCC 43290. GN=lp12_1208 OC=Legionellaceae; Legionella.
Sequence
MKTVNSQNGTSAEPSVNLGKLSTAKNLVFRGGGSKGIAYVGALQSLSEQGVLENIENVAG
SSAGAMTAAIVACGGSADLMEYFCSANSLEDFVDNPLTRKLAKLFMDKKGFLAGILIELF
KSNKMLPSDSSAAYTSLSHEQTDKQLDAKSSLAEAKLVTKPSKLTFPVASKGTKLVEAME
HVMRMAIFTHFPESLDNELKNVREKLNAIEDKGSAEYINLAKRQQIVEDTQKIINGLHDP
NFDLTFGHLHTLHQYDPQRFKELHITGTDENGELRIFSHEKDADMPVSIAVRISASLPGV
FDPVIYEGRKYIDGGAANNLPVNIFFNKEEAYTPGVVTTIGVSCENQLDITEKEFKNPSF
MERIKEYLGDFVKKILCKLDVEGAVKEQKREMLKYIDNGNLFVMVAPPISVTTAQMHIND
KEKEGVIEVGKAFCDMQLKSMIDADYKPQPFDEKAAKILTNSSQQQEQLKEKTMLFKSRL
QSFKQGEGVKPWSQHVENAIDRLMSLKGEITKAQVDLGRTWFDIKSENADPAVRLKKFND
AFLASPLAKPSSNQQEINFSKEIRKEIDLLKGLPGLNNTSSHCTEEFNEQSTPSLYRA
Download sequence
Identical sequences A0A2J9NK40 G8UTB9 Q5ZW60
272624.lpg1227 gi|378777137|ref|YP_005185574.1| WP_010946959.1.100881 WP_010946959.1.101385 WP_010946959.1.10160 WP_010946959.1.11666 WP_010946959.1.1188 WP_010946959.1.12035 WP_010946959.1.12661 WP_010946959.1.14235 WP_010946959.1.15016 WP_010946959.1.16078 WP_010946959.1.16593 WP_010946959.1.16748 WP_010946959.1.16962 WP_010946959.1.17857 WP_010946959.1.19321 WP_010946959.1.19554 WP_010946959.1.20369 WP_010946959.1.2062 WP_010946959.1.2085 WP_010946959.1.21466 WP_010946959.1.21493 WP_010946959.1.21924 WP_010946959.1.22734 WP_010946959.1.22766 WP_010946959.1.2333 WP_010946959.1.23459 WP_010946959.1.24053 WP_010946959.1.24333 WP_010946959.1.2441 WP_010946959.1.24636 WP_010946959.1.26718 WP_010946959.1.27038 WP_010946959.1.27501 WP_010946959.1.27674 WP_010946959.1.28814 WP_010946959.1.29318 WP_010946959.1.29802 WP_010946959.1.30583 WP_010946959.1.30653 WP_010946959.1.30822 WP_010946959.1.31291 WP_010946959.1.32608 WP_010946959.1.32615 WP_010946959.1.32659 WP_010946959.1.33479 WP_010946959.1.35787 WP_010946959.1.36420 WP_010946959.1.37108 WP_010946959.1.37274 WP_010946959.1.37932 WP_010946959.1.3819 WP_010946959.1.38679 WP_010946959.1.40870 WP_010946959.1.41185 WP_010946959.1.41486 WP_010946959.1.44619 WP_010946959.1.44866 WP_010946959.1.45024 WP_010946959.1.46042 WP_010946959.1.46096 WP_010946959.1.47823 WP_010946959.1.47956 WP_010946959.1.48346 WP_010946959.1.51153 WP_010946959.1.51956 WP_010946959.1.52283 WP_010946959.1.52706 WP_010946959.1.52905 WP_010946959.1.53250 WP_010946959.1.53261 WP_010946959.1.53669 WP_010946959.1.53795 WP_010946959.1.53844 WP_010946959.1.54355 WP_010946959.1.57055 WP_010946959.1.57468 WP_010946959.1.58541 WP_010946959.1.58606 WP_010946959.1.58931 WP_010946959.1.59227 WP_010946959.1.59576 WP_010946959.1.60239 WP_010946959.1.60770 WP_010946959.1.61895 WP_010946959.1.62077 WP_010946959.1.63282 WP_010946959.1.636 WP_010946959.1.64335 WP_010946959.1.64388 WP_010946959.1.64512 WP_010946959.1.64856 WP_010946959.1.66209 WP_010946959.1.66299 WP_010946959.1.68412 WP_010946959.1.68702 WP_010946959.1.69197 WP_010946959.1.70346 WP_010946959.1.70691 WP_010946959.1.7124 WP_010946959.1.71556 WP_010946959.1.73915 WP_010946959.1.74438 WP_010946959.1.75353 WP_010946959.1.75911 WP_010946959.1.76298 WP_010946959.1.76893 WP_010946959.1.77472 WP_010946959.1.77852 WP_010946959.1.77866 WP_010946959.1.79027 WP_010946959.1.79030 WP_010946959.1.79957 WP_010946959.1.80678 WP_010946959.1.80733 WP_010946959.1.80817 WP_010946959.1.81970 WP_010946959.1.82765 WP_010946959.1.83499 WP_010946959.1.8363 WP_010946959.1.84081 WP_010946959.1.85699 WP_010946959.1.86349 WP_010946959.1.86607 WP_010946959.1.87629 WP_010946959.1.87656 WP_010946959.1.88081 WP_010946959.1.89135 WP_010946959.1.89155 WP_010946959.1.89171 WP_010946959.1.90392 WP_010946959.1.90650 WP_010946959.1.91256 WP_010946959.1.91480 WP_010946959.1.93200 WP_010946959.1.94508 WP_010946959.1.9567 WP_010946959.1.96018 WP_010946959.1.96198 WP_010946959.1.97528 WP_010946959.1.97598 WP_010946959.1.97635 WP_010946959.1.98470 WP_010946959.1.98928 YP_095258.1.86292 APC40571 NYSGRC-FDAO-AAU27311 gi|509150550|ref|YP_008062924.1| gi|52841459|ref|YP_095258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]