SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8Y538 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8Y538
Domain Number 1 Region: 5-258
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.15e-61
Family Capz alpha-1 subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8Y538
Sequence length 265
Comment (tr|G8Y538|G8Y538_PICSO) Piso0_005441 protein {ECO:0000313|EMBL:CCE85806.1} KW=Complete proteome; Reference proteome OX=559304 OS=NBRC 10061 / NRRL Y-12695) (Hybrid yeast). GN=GNLVRS01_PISO0M14774g OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Millerozyma.
Sequence
MAQSVSLDSIIQSLVESSPPGELSEIVEDLNSVLPEEISSSIITQALENYIDKNCGIFSS
SYIASEYNKSPHSTKYADFIGKKLFNIDLGRQAAIDFEEFTPGVDYPEYYPELVSKLKEY
GDKQYPSKFAFTVIPSTDDVKIIVIGQRLNKENFYTGQWKSVYSLKEKVLEGTIKIDIHY
FEEGNVRLTYEDKVTNDVTMDARYIINTINTTENNIAVKIVENFNDLNQRSFKNLRRLLP
VTRSKINWGKAIGNYKLGSDVVHKK
Download sequence
Identical sequences G8Y538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]