SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G8ZZQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G8ZZQ4
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-66
Family Capz beta-1 subunit 0.000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G8ZZQ4
Sequence length 278
Comment (tr|G8ZZQ4|G8ZZQ4_TORDC) Uncharacterized protein {ECO:0000313|EMBL:CCE94098.1} KW=Complete proteome; Reference proteome OX=1076872 OS=NCYC 2629 / NRRL Y-866) (Yeast) (Candida colliculosa). GN=TDEL_0H02390 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Torulaspora.
Sequence
MSSTDSYDASLDLLRRLDPRRLKEHLQNLIKLEPSLAEDLLSSVDTPLTIKRDPKASQRE
YLCCDYNRDIDSHRSPWSNEYYPELSPEDLKESPFPSTELRKLEALANDSFDIYRDLYYE
GGVSSVYLWELDEDNTDDFAGVVLFKNKDQSSSCWDSIHVLEATRDGSDFTYRITTTIIL
HLDKGDQMSLSGNLTRQTERTVNVPAAESVTEEQLSVAHITNLGTLIEDVESQMRTMLEA
VYFEKTRDIFHQTKNSAPSAEEMNKEAHQELIKGLQGL
Download sequence
Identical sequences G8ZZQ4
XP_003683309.1.64532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]