SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9KUI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9KUI7
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 8.37e-45
Family Troponin I 0.000000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G9KUI7
Sequence length 152
Comment (tr|G9KUI7|G9KUI7_MUSPF) Troponin I type 3 {ECO:0000313|EMBL:AES08566.1} OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
QELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDVEAKV
TKNIAEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGTRAKETLDLRAHLKQVKK
EDTEKENREVGDWRKNIDALSGMEGRKKKFEG
Download sequence
Identical sequences G9KUI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]