SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9MNR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G9MNR6
Domain Number - Region: 167-256
Classification Level Classification E-value
Superfamily PG1388-like 0.0144
Family PG1388-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9MNR6
Sequence length 262
Comment (tr|G9MNR6|G9MNR6_HYPVG) Uncharacterized protein {ECO:0000313|EMBL:EHK23520.1} KW=Complete proteome; Reference proteome OX=413071 OS=(Trichoderma virens). GN=TRIVIDRAFT_36801 OC=Trichoderma.
Sequence
MSDDESLNYPLFRDCLSATILQPVPAPEPKRRRRAKAGRTSPIPAPAPDPDRDAEELADF
IDYLADGIFQNLPQDLQELDYRSWRESEELQAQYSLPLTPDSLSKLDLPSSICETLITYN
LIAPDPTQPSHLPPTPEAFLLPILTGYLTPLIEPPPATPSTRTDACELCERSWIPLSYHH
LIPRFVHDKAVKRGWHRKEDLQNVAWLCGACHRFVHRFKNHEDLARHYYTVELLLEEEEV
RKFAEWVGKLRWKGGKTRSRRY
Download sequence
Identical sequences G9MNR6
jgi|Trive1|36801|e_gw1.6.377.1 XP_013957738.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]