SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G9ZLI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G9ZLI2
Domain Number - Region: 17-59
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9ZLI2
Sequence length 115
Comment (tr|G9ZLI2|G9ZLI2_9LACO) Uncharacterized protein {ECO:0000313|EMBL:EHM00450.1} KW=Complete proteome; Reference proteome OX=797515 OS=Lactobacillus parafarraginis F0439. GN=HMPREF9103_00580 OC=Lactobacillus.
Sequence
MEKAALAFKEKFNEFITNYFKDHQELTGSYDIPSYYEHYTVHLDSRKGIVITLITGMNQA
GDNMTTALPFKQMETMSIEDFRNLILHKKFADQNMSLADVFQTVAGVPDSGKSED
Download sequence
Identical sequences G9ZLI2
WP_008211109.1.62470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]