SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0GHZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0GHZ7
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-42
Family Capz beta-1 subunit 0.00000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0GHZ7
Sequence length 154
Comment (tr|H0GHZ7|H0GHZ7_SACCK) Cap2p {ECO:0000313|EMBL:EHN06660.1} KW=Complete proteome OX=1095631 OS=(Yeast). GN=VIN7_2423 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSDAQFDAALDLLRRLNPTTLQENLNNLIELQPNLAQDLLSSVDVPLSTQKDSADSNREY
LCCDYNRDIDSFRSPWSNTYYPELSPKDLQDSPFPSAPLRKLEILANDSFDVYRDLYYEG
GISSVYLWDLNEEDFNGHDFAGVVLLQKKPIRSQ
Download sequence
Identical sequences E7NIU9 H0GHZ7
YIL034C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]