SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0VR94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VR94
Domain Number 1 Region: 4-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-114
Family Capz alpha-1 subunit 0.000000000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0VR94
Sequence length 278
Comment (tr|H0VR94|H0VR94_CAVPO) Capping actin protein of muscle Z-line alpha subunit 1 {ECO:0000313|Ensembl:ENSCPOP00000013095} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=CAPZA1 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
IVSDSEKNAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIE
GYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPHPEEIDGSLKSWRESCDSAL
RAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQV
VGVLKIQVHYYEDGNVQLVSHKDVQDSVNVSNEGQTAKEFIKIIENAENEYQTAISENYQ
TMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences H0VR94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]