SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0Y076 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0Y076
Domain Number 1 Region: 321-378
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 9-51
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000152
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0Y076
Sequence length 378
Comment (tr|H0Y076|H0Y076_OTOGA) General transcription factor IIA subunit 1 {ECO:0000313|Ensembl:ENSOGAP00000021769} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=GTF2A1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
WANCSISYLLPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH
SEEQQLLLQVQQQHQPQQPQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIV
PDSKLIQHMNASNMNSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIIQPQ
QSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPPQILFTGNKTQVIPTT
VAAPTQAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDFDDDDEEED
KEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIM
NLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences H0Y076
ENSOGAP00000021769 ENSOGAP00000021769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]