SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1A4K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1A4K1
Domain Number 1 Region: 8-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.58e-115
Family Capz alpha-1 subunit 0.000000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1A4K1
Sequence length 287
Comment (tr|H1A4K1|H1A4K1_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000017817} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=CAPZA1 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence
MADLDERVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKLSFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKF
TITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKDFIKIIENAENEY
QTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences H1A4K1
ENSTGUP00000017817 ENSTGUP00000017817 59729.ENSTGUP00000017817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]