SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1L1B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H1L1B8
Domain Number - Region: 114-235
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0196
Family Capz alpha-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H1L1B8
Sequence length 272
Comment (tr|H1L1B8|H1L1B8_9EURY) Uncharacterized protein {ECO:0000313|EMBL:EHP83878.1} KW=Complete proteome OX=647171 OS=Methanotorris formicicus Mc-S-70. GN=MetfoDRAFT_1842 OC=Methanocaldococcaceae; Methanotorris.
Sequence
MYGTDFFFIPNKFWTIKNETNEYIEVYNNTTQKTLRIKREFLTKVLRKPNIFANRIVVKP
SSYALSIPEDLDFDYDLKEYINYGVKSGTAKFSIKAWREKWYSHIYKQIQKKQPYGNIFL
PDKVDSAFKHRGVFANYTEKDTIATKNFYILKIKDKEAQKLLTLWFNSTIFLSIFVSMGK
KISDRFIRFLGQDYLYGLIPNINNIDNDLKTDMINLFDSIKDKKFPPLKHQFEIDEFSKI
RYTLDSLILEAIGIDDIEIQNNIYRYIKKKLI
Download sequence
Identical sequences H1L1B8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]