SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1PYI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H1PYI3
Domain Number - Region: 61-140
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00144
Family Capz alpha-1 subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1PYI3
Sequence length 243
Comment (tr|H1PYI3|H1PYI3_9FUSO) Uncharacterized protein {ECO:0000313|EMBL:EHO77172.1} KW=Complete proteome OX=457404 OS=Fusobacterium ulcerans 12-1B. GN=HMPREF0402_03476 OC=Fusobacterium.
Sequence
MKKYRLGYDQVFLAHPGIKMGNEVLGGVTLDIQYKLFDIKSGLEIAFTDKDQSIGKGVQS
ISEYAEIEDYYMSDFLKCSFDKNHAGYVKFEIKNEEILKQWNYRLEYEISSYSKDIYTDN
SCICAEPKEITKEEFYKILSENISNFDNIDNTLGTQSCSYTTYPIEEDKENEEDMKKYVV
EIVVASNKKRLYLTEGGCTTDIKKGKIYRNIRIAEGKLIEFCFEHSHSGALQGTIIEIKN
QEE
Download sequence
Identical sequences H1PYI3
WP_008699415.1.34088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]