SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1V5I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1V5I3
Domain Number 1 Region: 5-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.32e-84
Family Capz beta-1 subunit 0.000000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H1V5I3
Sequence length 283
Comment (tr|H1V5I3|H1V5I3_COLHI) F-actin-capping protein subunit beta {ECO:0000313|EMBL:CCF35485.1} KW=Complete proteome; Reference proteome OX=759273 OS=fungus). GN=CH063_01322 OC=Colletotrichum.
Sequence
MTSVDPFDSALDLLRRLNPKHTTDHLNAIISLAPDLTEDLLSSVDQPLTVKRCKQTGRDY
LLCDYNRDGDSYRSPWSNQFDPPLDEAGAGGVGAGGSEGAGEGAIPSERVRKMEVRANEA
FDVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSATPGGSAEGIWDSIHVFEAIERGRTT
QYKLTSTVILSLSTSTGALGDMDLSGNMTRQVEQELPVEGDESHIANVGRLVEDMELKMR
NLLQEVYFGKAKDVVGDLRSVGSLSEGARDRAAQREIIGSMQR
Download sequence
Identical sequences H1V5I3
XP_018163812.1.57863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]