SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1VDH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H1VDH2
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-87
Family Capz alpha-1 subunit 0.0000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H1VDH2
Sequence length 271
Comment (tr|H1VDH2|H1VDH2_COLHI) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:CCF38275.1} KW=Complete proteome; Reference proteome OX=759273 OS=fungus). GN=CH063_09407 OC=Colletotrichum.
Sequence
MSQVETVSSFVEGAPPGELADVIADIKSLTVSDPDIVSSLEPAFEKYNEEQFVTVKLPGG
SQQVIISSHSSLGDGQYFDVESSTSFSFDHTTQKASNVQSYVLESANAELIKSTLKSLGP
YVQEHFPNAAYGVYPTANDTQVAVVIVSNKYSPNNFWNGRWRSLYIFDPASSSLEGSVKV
DVHYYEDGNVRLLTNRPSQASVSSGTGAGIVKEISTSEKKYQEELNRGFTNLSEGAFKGL
RRQLPVTRQKIEWDKITSYRLGQDIGGGARR
Download sequence
Identical sequences H1VDH2
XP_018157793.1.57863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]