SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H1Y6X4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H1Y6X4
Domain Number - Region: 62-142
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz beta-1 subunit 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H1Y6X4
Sequence length 210
Comment (tr|H1Y6X4|H1Y6X4_9SPHI) Uncharacterized protein {ECO:0000313|EMBL:EHQ28381.1} KW=Complete proteome; Reference proteome OX=714943 OS=Mucilaginibacter paludis DSM 18603. GN=Mucpa_4291 OC=Sphingobacteriaceae; Mucilaginibacter.
Sequence
MKKLVNILAVALVLAGCSQSSTRSGKSADAPQLNQEQLDSVARYNKYKSTLNVVFGKVTF
GISPQEFKKLVGDKPVVVGNSSYSADPSFTTKTNELYMVDLESDLKTANYIETELNDDMD
NITSVITAKYGPPTRDDGKIQFFNFKPGYYQFVRYWDLYTKTIAIGMEEAYTGSEYRVVC
QIYNKKMKQEEKELEATKTESKTIADTSKF
Download sequence
Identical sequences H1Y6X4
WP_008509168.1.83696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]