SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2AMU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2AMU3
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-69
Family Capz beta-1 subunit 0.000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2AMU3
Sequence length 283
Comment (tr|H2AMU3|H2AMU3_KAZAF) Uncharacterized protein {ECO:0000313|EMBL:CCF55693.1} KW=Complete proteome; Reference proteome OX=1071382 OS=africanus). GN=KAFR_0A02570 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kazachstania.
Sequence
MSSEGDKYDAALDLLRRLNPVKINSNLQNVINLEPTLAEDLLSSIDVPLKISNDPGFSNR
EYLCCDYNRDLDSFRSPWSNEYFPKLSDDVLMDSPFPSESLRQLEILCNDSFDVYRDLYY
EGGVSSVYLWDLEDDENAEDFAGVVLFKKSNKSKNHWDSVHVVEVVSTNGNTFQYKVTTT
IILQLEKDDSESQKLLRLSGNLTRQTEKTLSVDANSLEQTHIAHVTNLGVLIEDVESQMR
NLLETVYFEKTRDIFHQVRNGATIEDQLNQTAHAEVIKGLQNL
Download sequence
Identical sequences H2AMU3
XP_003954828.1.94514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]