SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2AUD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2AUD3
Domain Number 1 Region: 4-257
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-69
Family Capz alpha-1 subunit 0.0000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2AUD3
Sequence length 263
Comment (tr|H2AUD3|H2AUD3_KAZAF) Uncharacterized protein {ECO:0000313|EMBL:CCF57983.1} KW=Complete proteome; Reference proteome OX=1071382 OS=africanus). GN=KAFR_0D03350 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kazachstania.
Sequence
MSLNFESIVSDIISDSPAGEIKEIYNDLITIAGENAKQTILEAIEQYNIKNALPIDVNGK
SVIISEYNRQGTKYFDPKTSTSFSVDHLNRTGLDIESNDVKLTTSQELIYDSLENYIKSN
FPGEVAFGLYPIPEEENKIAIIIFGNKYNQGSFWTGDWKSKYVYDIEEKKLTGSIAVQVH
YFEDGNVNFEACEKVDLNDVNDVVESLSQVESKFEKDLDSSFTDLNEKQFKVLRRKLPIT
RSKVSWGKAIGNYRLGKDAAQGK
Download sequence
Identical sequences H2AUD3
XP_003957118.1.94514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]