SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MSA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2MSA6
Domain Number - Region: 46-106
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0327
Family Probable GTPase Der, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2MSA6
Sequence length 118
Comment (tr|H2MSA6|H2MSA6_ORYLA) Transmembrane protein 243 {ECO:0000313|Ensembl:ENSORLP00000021643} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=TMEM243 OC=Oryziinae; Oryzias.
Sequence
MDEFSTRTYGTSSGLDNRPLFGETSARDRIINLAVGGVTFVVVLVTVIGSFVFPTPPPRP
LNVFFAVCILLACGSTIVLIYWYRQGDLEPKFRNLIYYMLGSIVLLCLCANLYFFDVS
Download sequence
Identical sequences H2MSA6
ENSORLP00000021643 XP_004083290.1.28442 XP_020569969.1.28442 XP_020569970.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]