SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2MSY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2MSY6
Domain Number - Region: 104-139
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0798
Family Moesin tail domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MSY6
Sequence length 197
Comment (tr|H2MSY6|H2MSY6_ORYLA) Family with sequence similarity 167, member B {ECO:0000313|Ensembl:ENSORLP00000021879} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=fam167b OC=Oryziinae; Oryzias.
Sequence
LERFSRPVTRMDFKEFGEESSDGEAEGLDSVKALTEKLKLETRRPSYLEWQERVLGRPWK
ERSAGDSPDPEGQAVAMPAVLRNEDSELTVRNICGFDTIDDALDFLRKELREMQVQDNRL
ARQLIRLRSEIHRLKVEQVCHRHKEMLDDASYELEECGEESDLLCDIPMKAAFALSTPLK
HLGLTKMNINSRRFSLC
Download sequence
Identical sequences H2MSY6
ENSORLP00000021879 8090.ENSORLP00000021879 ENSORLP00000021879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]