SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2MZG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2MZG7
Domain Number 1 Region: 10-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.02e-114
Family Capz alpha-1 subunit 0.000000000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2MZG7
Sequence length 286
Comment (tr|H2MZG7|H2MZG7_ORYLA) Uncharacterized protein {ECO:0000313|Ensembl:ENSORLP00000024471} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=capza2 OC=Oryziinae; Oryzias.
Sequence
MADHEEQLPDEEKVRIAANFVIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEEQVLITEHGDLGNGRVLDPKNKISFKFDHLRKEASDPRPHDVDSSMEGW
RSAVDSSVRAYVKEHYPSGVCTIYGKTIDGHQTIIVCIECHQFQPKNFWNGRWRSEWKFT
ISPSTTQVAGIMKIQVHYYEDGNVQLVSHKEVQESMSISNEASTAKEFVKIMEAAENDYQ
TAINENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences H2MZG7
XP_004086274.1.28442 ENSORLP00000024471 8090.ENSORLP00000024471 ENSORLP00000024471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]