SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q818 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q818
Domain Number 1 Region: 4-65,104-224
Classification Level Classification E-value
Superfamily Proteasome activator 7.98e-68
Family Proteasome activator 0.0000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Q818
Sequence length 250
Comment (tr|H2Q818|H2Q818_PANTR) Proteasome activator subunit 1 {ECO:0000313|Ensembl:ENSPTRP00000010514} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0029693 OC=Catarrhini; Hominidae; Pan.
Sequence
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYVRRRGQGRGGQRQLSQA
THSLTLQARG
Download sequence
Identical sequences H2Q818
ENSPTRP00000010514 ENSPTRP00000010514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]