SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2S0G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2S0G8
Domain Number - Region: 4-99
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2S0G8
Sequence length 462
Comment (tr|H2S0G8|H2S0G8_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000005889} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
RLQDEFLQAQNEIRHLLSDKQTLQHQMKLQAADFQKSLLAKSKRLEELQQQTMSPLQQEM
LKAQMQQEMDAPVREMRLQLEEEIEKYKAEYYKLRYECLRLQSQADQQREEHARALESQR
LRYQAEMSCLQTDKEALAARLQSSDQRSNDKKLEALMKERVQLKVRNQGLEAEVAELLAQ
RETKRQQADNVAKVLNKQLTDSQDLARSLGVRLQRRHLGSAWLFPQLXSHKQDVNSLQLE
FMLSQQELEKEKEAYKGQTEGNEHVHVWSLSNGIKTNDHFLRMCASVLRTEVELLRAEIT
QLREVLMEKEEEMCRKVHWVHEEGLHKAAQVQKERLELEKHMTQTDAAVKDQLGKWLECL
NQAKHREESMSKELKDLRTELQQQRSQILEHQSHKVQMGELQQRNNKLEEELRNVSNSQE
QLRETNKQLQGSLERVREELRTTQVQAERSQQEAERSQQEAE
Download sequence
Identical sequences H2S0G8
31033.ENSTRUP00000005889 ENSTRUP00000005889 ENSTRUP00000005889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]