SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2THN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H2THN7
Domain Number - Region: 28-123
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2THN7
Sequence length 440
Comment (tr|H2THN7|H2THN7_TAKRU) Centrosomal protein 83 {ECO:0000313|Ensembl:ENSTRUP00000024187} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=cep83 OC=Takifugu.
Sequence
MLIDERIKSENFRTQYQSLKEETTRLQDEFLQAQNEIRHLLSDKQTLQHQMKLQAADFQK
SLLAKSKRLEELQQQTMSPLQQEMLKAQMQQEMDAPVREMRLQLEEEIEKYKAEYYKLRY
ECLRLQSQADQQREEHARALESQRLRYQAEMSCLEADKEALAARLQSSDQRSNDKKLEAL
MKERVQLKVRIQGLEAEVAELLAQKESLSQQAEKTQSIQNRRLTESQAALKSLEAERESV
RLQLEKMQKELHLSNEESCQLTKRLHGAERQVTSLTCQVESLKFSHKQEVNNIKLEFTLS
QGELEKERNKLQALIEGFQTEVELLRAEITQLKAALVEKEREMCRKVQSVRDEEFRRTVE
LQEEKLELEHHLSSMQQQTSLKEAAAREQMADWEERLSSAKLREESASGELQRLRTELQQ
QRSQILEHQSHKVQMGELQQ
Download sequence
Identical sequences H2THN7
ENSTRUP00000024187 31033.ENSTRUP00000024187 ENSTRUP00000024187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]