SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2TJF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TJF7
Domain Number 1 Region: 3-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-96
Family Capz beta-1 subunit 0.000000000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TJF7
Sequence length 274
Comment (tr|H2TJF7|H2TJF7_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000024811} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=capzb OC=Takifugu.
Sequence
MTEKQLDCALDLMRRLPPQQIEKNLSDLIDLVPGLCEDLLSSVDQPLKIARDKVVEKDYL
LCDYNRDGDSYRSPWSNKYDPPIEDGAMPSDRLRKLEIEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRSAHYKLTSTVMLWLQTT
KSGSGTMNLGGSLTRQMEKDDTVGESSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NSLRSIESLPDNQKYRQLQKELSQVLTQRQIFID
Download sequence
Identical sequences H2TJF7
ENSTRUP00000024811 31033.ENSTRUP00000024811 ENSTRUP00000024811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]