SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2V3V3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V3V3
Domain Number 1 Region: 232-442
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.59e-86
Family Capz alpha-1 subunit 0.0000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2V3V3
Sequence length 447
Comment (tr|H2V3V3|H2V3V3_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000043887} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=capza2 OC=Takifugu.
Sequence
MADYEEQLSDEEKVKSLISPRRRPRWRTFALAFAATFDRVRRRNPAAADVALDRVGANDL
PLAQAIVLSKEPSGSKARSDPLKIPSEHLPFNAKTALFCLNTSVRAELCALAQYRIRAAA
AIMVFVFTGENAAHMQGKAFGSGDPVRTAPGPGTEFLGWLCAVAAEQPGRSLMLNNCNVW
AESNAGVDTSAPRERAFMKPSSYISECRHLGVVPQAVCLPLITAQEPNNIPVPRAFAQYN
LDQFTPVKIEGYEEQVLITEHGDLGNGRVLDPKNKISFRFDHLRKEASDPQPHDVDGSIE
SWRTAVDSAVRAYVKEHYPNGVCTIYGKTIDGQQTIIVCIECHQFQPKNFWNGRWRSEWK
FTISSSSTEVAGIMKIQVHYYEDGNVQLVSHKEVQDSMSISMAINENYQTMSDTTFKALR
RQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences H2V3V3
ENSTRUP00000043887 ENSTRUP00000043887 31033.ENSTRUP00000043887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]