SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2VC88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2VC88
Domain Number 1 Region: 2-222
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.41e-46
Family Capz alpha-1 subunit 0.000000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2VC88
Sequence length 224
Comment (tr|H2VC88|H2VC88_TAKRU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTRUP00000046831} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
QVRIVADFLKHTPPGEFNEVFNDIQILLNNDGLLKEGAAHVFAQYNMEQFILAKIDGFDD
KAKHGVLRNGRFVDPHNKISLKFDHLWRDACESALKDYIAQYYPSGVCTVVYGKRIDGQK
IITACIEGHQFEPEDYDKSIEPYLNICLVSSILQVYYYEDGNMQLVSHKDIRDSIIISNA
DFTFKQLNILFHFILKVAIGEHDQAMSDTFKALRRQLPVTHNSL
Download sequence
Identical sequences H2VC88
ENSTRUP00000046831 ENSTRUP00000046831 31033.ENSTRUP00000046831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]