SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3AI80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3AI80
Domain Number 1 Region: 393-519
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000001
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 2 Region: 329-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 297-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000062
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  H3AI80
Domain Number - Region: 370-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000174
Family EGF-type module 0.0089
Further Details:      
 
Domain Number - Region: 258-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0449
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 155-206
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0549
Family Capz alpha-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3AI80
Sequence length 723
Comment (tr|H3AI80|H3AI80_LATCH) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=DLL1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MGRQYLLLVAIVSAMVFQVSCSGVFELKLQEFLNKKGVVGNVNCCKGGAASGILQCECKT
FFRICLKHYQVNVSPEPPCTYGSAITPVLGSNSFQISETSADLSFTNPIRFPFSFTWPGT
FSLIIEAMHAESPDDLTTDNPDRMISRLTTQRHLTVGEEWSQDLHTSGNTELKYSYRFFC
DEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKSRYCSEPICLPGCDEQHGYCER
PGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCK
NGATCTNTGQGSYTCSCRPGFTGSNCEIEINECDANPCKNGGSCTDLENSYSCTCPPGFY
GKNCELSAMTCADGPCFNGGKCSDNPGGGYACQCPVSYSGFNCEKKIDHCSSNPCANGAQ
CLDLGNSYICKCQAGFTGMHCSDNVDDCASFPCLNGGTCQDGINDYTCTCPPGYSGKNCS
APVSKCEHSPCHNGATCHERNNRYVCECAQGYGGLNCQFLLPEQPKVPTVIVDLTEKYTE
GNDGQFPWIAVCAGIILVLMLLLGCSAIVVCVRVKMQKRRCQSDICKSEAETMNNLTDCQ
REKDISISVIGATQIKNTNKKVDFHSENTAEKNGYKVRYPSVDYNLVHELKHEDSVKEEH
DKCEAKCDSSDSEVEEKNTVQLKSESSERKRPESVYSTSKDTKYQSVYVISGEKDECIIA
TEV
Download sequence
Identical sequences H3AI80
ENSLACP00000009351 ENSLACP00000009351 XP_014349975.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]