SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3B4E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3B4E7
Domain Number 1 Region: 13-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.15e-111
Family Capz alpha-1 subunit 0.000000000891
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3B4E7
Sequence length 286
Comment (tr|H3B4E7|H3B4E7_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000016768} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=CAPZA2 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
LPETSSVLSAGFKVRVAANFIIHAPPGEFNEVFNDVRLLLNDDNLLREGAAHAFAQYNLD
QFTPVKIEGYDEQVLITEHGDLGNGRFFDPKNKVSFKFDHLRKEACDVRPQEVENALESW
RNAVDSAVRLYVKEHYPNGVCTVYGKTIDGHQTIIVCIESHQFQAKNFWNGRWRSEWKLT
ITPATAQVMGILKIQVHYYEDGNVQLVSHKDVQESLPVSTEAQTVKEFIKILEAAENDYQ
TAINENYQTMSDTTFKALRRQLPVTRTKVDWNKILSYKIAKEITPY
Download sequence
Identical sequences H3B4E7
ENSLACP00000016768 ENSLACP00000016768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]