SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3BEW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BEW8
Domain Number 1 Region: 15-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-113
Family Capz alpha-1 subunit 0.000000000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3BEW8
Sequence length 292
Comment (tr|H3BEW8|H3BEW8_LATCH) Uncharacterized protein {ECO:0000313|Ensembl:ENSLACP00000020439} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=CAPZA1 OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
SSDSHHEGTSPLTCIGKVRIAATFITHAPPGEFNEVFNDVRLLLNNDNVLREGAAHAFAQ
YNMDQFTPAKIEGHDDQVLITEHGDLGNSRFLDPRNKLSFKFDHLRKEASDPQYHDVEAA
VKPWRDACDSALRAYVKEHYPTGICTVYGKTIDGQQTVIACVESHQFQPKNFWNGRWRSE
WKFTVTPPTAQVVGVLKIQVHYYEDGNVQLVSHKDIQESVTVSNEAQTAKEFIKIIENAE
NEYQTAISENYQAMSDTTFKALRRQLPITRSKVDWHKILNYQIAKEMQNPLN
Download sequence
Identical sequences H3BEW8
ENSLACP00000020439 ENSLACP00000020439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]