SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3C9P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3C9P5
Domain Number 1 Region: 45-77
Classification Level Classification E-value
Superfamily Notch domain 0.00000034
Family Notch domain 0.0024
Further Details:      
 
Domain Number 2 Region: 6-37
Classification Level Classification E-value
Superfamily Notch domain 0.00000196
Family Notch domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3C9P5
Sequence length 200
Comment (tr|H3C9P5|H3C9P5_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000004967} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
NPWGQCPVNRNCRDKFGDGSCDRECMAPGCLRDGLDCLKDRGHCNPGHIQYCRDHYGNSH
CEQGCDSAPCGWDGSDCFANQAPQWAKGTLVLHTKLPHQRSGFSNSSLFWALSVLLQTPV
KLRASAPMSANRNLFDFDPSQLASMLTQSSPADSVSYSSLLFLQVDNRPCSRLQTTCFPY
ATEAASFLRATTMLRPPSFP
Download sequence
Identical sequences H3C9P5
99883.ENSTNIP00000004967 ENSTNIP00000004967 ENSTNIP00000004967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]