SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3EV90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3EV90
Domain Number 1 Region: 8-285
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.07e-90
Family Capz alpha-1 subunit 0.000000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3EV90
Sequence length 291
Comment (tr|H3EV90|H3EV90_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA13728} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00103282 OC=Neodiplogasteridae; Pristionchus.
Sequence
MAAGEGAISDSEKVRIASDFLLHAPPGEFNEVFNDVRMLLKNDTLLREGCAPVFAQYNRE
QFVPVKLEGVDKKTLVTPYNDIGGGRFVDDHSGKSFKFDHLRREAVDVADAPGIEAKLEP
WRAALQTELDAYIDEHFSHGGIGCVFQSRGAGGGLVMCIESHQFAPTNYVNGRWRSEWHV
PVGDGQSGVQDMKGQIKCQVHYYEDGNVQLFSDKPTTVKVNVSSDPSKTAKEVLRAISEE
EAAYQTAIQENYTTMSESTFKALRRQLPVTRAKMDWLKVQSYRIGAEIKPQ
Download sequence
Identical sequences A0A2A6BW36 H3EV90
PPA13728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]