SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H5S9L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H5S9L7
Domain Number - Region: 26-129
Classification Level Classification E-value
Superfamily Double Clp-N motif 0.051
Family Double Clp-N motif 0.019
Further Details:      
 
Domain Number - Region: 71-194
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0915
Family Capz beta-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H5S9L7
Sequence length 216
Comment (tr|H5S9L7|H5S9L7_9GAMM) Hypothetical conserved protein {ECO:0000313|EMBL:BAL52853.1} OX=86473 OS=uncultured gamma proteobacterium. GN=HGMM_F03E05C16 OC=Bacteria; Proteobacteria; Gammaproteobacteria; environmental samples.
Sequence
MGKLVLARCQRLYYRLAESAVGSHKRDFLVSEVEEARASLEDTRDQFQTALDKFTALIRF
DGGNLTAFYRELKREFDRCEQKAEKVKSHISTIEDLAQALFDEWEWELEQYKSRTLRNKS
RQKLKLTQHHCRQLIQAMHKAESKIDPVLDAFRDQVLFLKHNLNAQAVAALQHELNVVSA
DIAAMIAVMEHSIRQADQFMQALAPASLPSPNRDGS
Download sequence
Identical sequences H5S9L7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]