SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H5TE24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H5TE24
Domain Number 1 Region: 163-243
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000765
Family alpha-Amylases, C-terminal beta-sheet domain 0.007
Further Details:      
 
Weak hits

Sequence:  H5TE24
Domain Number - Region: 48-149
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00523
Family Capz beta-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H5TE24
Sequence length 245
Comment (tr|H5TE24|H5TE24_9ALTE) Uncharacterized protein {ECO:0000313|EMBL:GAB56551.1} KW=Complete proteome; Reference proteome OX=1121923 OS=Glaciecola punicea ACAM 611. GN=GPUN_2436 OC=Alteromonadaceae; Glaciecola.
Sequence
MTFIPQFIKLIVFSLVLLIIACTPTNQSGDYNLPNDPNILPSWYGQSYDLFFNTSPAQIP
LLAKSLNDLSKATKVNDGSLAAQKSLIIENVLTRSLSSSIENEARLAIEQQRNEQFIAHQ
FASLGELYLSPKDNDYLQQNETWSQYVDSLIALGDEFDVFKQGEIDIYTASEEFSLFAYQ
RTLGNTRAFVAFNFSFDTVEVPLPFGFMTSTKITMWQSDSPKATTFVTSQALMIRPYTAV
IIIVG
Download sequence
Identical sequences H5TE24
WP_006006813.1.63262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]