SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H6CAL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6CAL0
Domain Number 1 Region: 3-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.11e-75
Family Capz alpha-1 subunit 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H6CAL0
Sequence length 282
Comment (tr|H6CAL0|H6CAL0_EXODN) Capping protein (Actin filament) muscle Z-line, alpha {ECO:0000313|EMBL:EHY60174.1} KW=Complete proteome; Reference proteome OX=858893 OS=(Black yeast) (Wangiella dermatitidis). GN=HMPREF1120_08144 OC=Exophiala.
Sequence
MGSTVDIASSFIEGAPPGELHEVVKDIKTLTSDDDPALIAKLKPAFQRYNEEQLVAVKLP
GSNDYVLISKYNKLPSSSSSYYDTRTSKSFDFDHTTSIASNVQSYSHETQHGSLIQSLLQ
SLSGSFADHYPPTTAAAYTVCEVPNNTNQIAILLSTTKASPKNFLSGRWRSVFLYDTTDS
TLSGEIKVDVHYYEDGNVALSTAKKFDAVSVSGNNPDADTIVRKITVTENQYQEEVNRAF
VGMNETSFRHLRRQLPVTRQKVEWEKVKGYSLGSDLKGEAKR
Download sequence
Identical sequences H6CAL0
XP_009160635.1.97914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]