SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H6PCA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6PCA5
Domain Number 1 Region: 221-384
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-28
Family Histidine kinase 0.0032
Further Details:      
 
Domain Number 2 Region: 161-230
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000569
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Weak hits

Sequence:  H6PCA5
Domain Number - Region: 30-107
Classification Level Classification E-value
Superfamily PG1388-like 0.0915
Family PG1388-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H6PCA5
Sequence length 385
Comment (tr|H6PCA5|H6PCA5_STRIC) Regulation of D-alanyl-lipoteichoicacid biosynthesis, sensor histidine kinase {ECO:0000313|EMBL:AEZ63051.1} KW=Complete proteome; Reference proteome OX=1069533 OS=Streptococcus infantarius (strain CJ18). GN=Sinf_1758 OC=Streptococcus.
Sequence
MKNLRLKFVLITMSMLTAMVLVLLVIGERYDKYWDEYDTYRIVKLVAANGYVKENTDEAI
AFVTIDENDKPDIQVNNTFLTNKEVKEVSKDLLNRGKKSWKWHDYIYSLKEKKDGTWQLV
FIDFSSYSASYAQIFLITVYVIFGLLLLTGVSIYLSRFIVQPAQAEIDREKQFVSDASHE
LKTPIASIRANAQVLQNQIAPNRYLNHILSETKRMEHLIQELLGLSKLDDKDGRAHFEKV
DLSSICQEMILSYESLAYEEGKLIEDQIAENIEILGQESQLKQLVTILLDNAIKHSLDNG
KITVELLQEKKTALLRVSNPSLVYPDEVLKNLFERFYQAEDSRNSSSSFGLGLAIAKAIL
EKYKGSITVSQADSQLTFEVQLPLK
Download sequence
Identical sequences H6PCA5
WP_015695708.1.40857 gi|379706063|ref|YP_005204522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]