SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H8X6N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H8X6N4
Domain Number 1 Region: 3-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-68
Family Capz beta-1 subunit 0.000000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H8X6N4
Sequence length 292
Comment (tr|H8X6N4|H8X6N4_CANO9) F-actin-capping protein subunit beta {ECO:0000313|EMBL:CCG23645.1} KW=Complete proteome OX=1136231 OS=Candida orthopsilosis (strain 90-125) (Yeast). GN=CORT_0E00550 OC=Candida/Lodderomyces clade; Candida.
Sequence
MAEDKFDASLDLLRRLDPHSIEKNLTSICSLITASKFSDTELVEALLSSVDVPLSIAQCK
DSGKDYLCCDYNRDGDSYRSPWSNKYYPQPEDDEDQPPPYPSSILRQLEIKANDAFDIYR
DLYYEGAGVSSVYFWDTAEDEEAEEDLSNGFAGVVLFKKETSDQSGKWDSIHVLEVVPET
KTRSTYKLTTSVILDLQHKSKNGLSLSGNLTRQLESSITADINNGVNLETSHLINIGTLI
EKAEYNIRNVLQEVYFDKLKDIMLKDLRSINGGSSKDINDNQKDIIKGLQSL
Download sequence
Identical sequences H8X6N4
XP_003869778.1.30900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]