SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9J3F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9J3F1
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-49
Family Calponin-homology domain, CH-domain 0.000000503
Further Details:      
 
Domain Number 2 Region: 271-332
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.15e-21
Family EB1 dimerisation domain-like 0.00016
Further Details:      
 
Domain Number 3 Region: 167-207
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000163
Family Calponin-homology domain, CH-domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9J3F1
Sequence length 350
Comment (tr|H9J3F1|H9J3F1_BOMMO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:BGIBMGA004038-TA} KW=Complete proteome; Reference proteome OX=7091 OS=Bombyx mori (Silk moth). GN=693103 OC=Bombycoidea; Bombycidae; Bombycinae; Bombyx.
Sequence
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSNFAKIEELCTGAAYCQFMDMLFPGSVPMKR
IKFKTNLEHEYIQNFKILQAGFKKMGVDKVIPVDKLIKGRFQDNFEFLQWFKKFFDANYD
GRDYDAFEARCGIPLGSGICDPGVPLCGIMQPPPTRARRPAPIQHSGIPIDKLVKGRFQD
NFEFLQWFKKFFDANYGGAAYDAVAQREGLPMGHGGSAAPRAAAAKKPVAPVAKVAARPQ
TIGKANTTVRSPPVNLSRISQSAKGDSKVVDELNHQINELKATVDGLEKERDFYFGKLRD
IEVICQEMEEQHNAPIVQKILDILYATEDGFAPPEEIDGDNPHPPEEDEY
Download sequence
Identical sequences H9J3F1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]