SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H9JT03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H9JT03
Domain Number 1 Region: 9-283
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-102
Family Capz alpha-1 subunit 0.0000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H9JT03
Sequence length 288
Comment (tr|H9JT03|H9JT03_BOMMO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:BGIBMGA012665-TA} KW=Complete proteome; Reference proteome OX=7091 OS=Bombyx mori (Silk moth). GN=LOC101738938 OC=Bombycoidea; Bombycidae; Bombycinae; Bombyx.
Sequence
MAADGDEVISDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLNNDTLLKEGASGAFAQYNK
DQLTPVRLEGSELYTLITDHNELGGGRFFDPRSKCSFRYDHLRKEASEYEPYEPDRAAEP
WRAALDEELTAYVAAHYKHGASLVVGRTVDSGTVQLVACIEDHQFQPKNYWNGRWRSVWS
LTVGGPATELRGTLRVQVHYYEDGNVQLVSSKEIKAPLVASGEVATAKEFVRLVSDAENT
YQTAISDNYKTMSDTTFKALRRQLPVTRSKIDWARLVSYTIGKELKSQ
Download sequence
Identical sequences H9JT03
XP_004926999.1.14763 Bmb006486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]