SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I0UQY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I0UQY1
Domain Number - Region: 53-106
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0706
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I0UQY1
Sequence length 137
Comment (tr|I0UQY1|I0UQY1_9MICC) Uncharacterized protein {ECO:0000313|EMBL:EID50284.1} KW=Complete proteome; Reference proteome OX=1125724 OS=Rothia aeria F0474. GN=HMPREF1324_0397 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Rothia.
Sequence
MHVKRSLHIRDLKSIEHKIATFNNHIKTNFDWLDFQVTSLDFTKLNIIASYDPSYYLNYN
IDLYSTKYLSGNLTWTIDIDKNATAAEIISSKEYTYLPREQENHFFLRFNNTDLESSPFT
IMANDISISYEKKYFNI
Download sequence
Identical sequences I0UQY1
WP_006889034.1.34264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]