SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I0YVI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I0YVI5
Domain Number - Region: 25-73
Classification Level Classification E-value
Superfamily G protein-binding domain 0.068
Family Rabaptin-5 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I0YVI5
Sequence length 79
Comment (tr|I0YVI5|I0YVI5_COCSC) Twin arginine-targeting protein trans {ECO:0000313|EMBL:EIE22404.1} KW=Complete proteome; Reference proteome OX=574566 OS=Coccomyxa subellipsoidea (strain C-169) (Green microalga). GN=COCSUDRAFT_33505 OC=Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa.
Sequence
MGLFGLGVPEIAVIAGVAVLIFGPSKLPELGRELGKSVKSFQTAAKEFESELKSGAEDAE
EEGKKMVDSVKESVDEKLK
Download sequence
Identical sequences I0YVI5
jgi|Chlvu1|67993|fgeneshCV_kg.C_scaffold_12000031 XP_005646948.1.71052 jgi|Coc_C169_1|33505|fgenesh1_kg.10_#_74_#_258_1_CBOZ_CBPA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]