SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1CE01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1CE01
Domain Number 1 Region: 57-330
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.32e-67
Family Pseudouridine synthase I TruA 0.0002
Further Details:      
 
Weak hits

Sequence:  I1CE01
Domain Number - Region: 326-395
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0654
Family Capz alpha-1 subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1CE01
Sequence length 450
Comment (tr|I1CE01|I1CE01_RHIO9) tRNA pseudouridine synthase {ECO:0000256|RuleBase:RU003792} KW=Complete proteome; Reference proteome OX=246409 OS=43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar). GN=RO3G_11392 OC=Rhizopodaceae; Rhizopus.
Sequence
MESKYSEYTREQLLKRIAELESQSAAKRNDTDNTEELKHKKPKKQGKNRPFDMTKYTKRK
IALRVAYIGWNYIGFASQQDPERIPTIEDMLFKALKECKLVAEIDDSIDYTRCGRTDRGV
SGLGQVIALWVRSKKLTSDPSPDLLPAEQEFPYVDTLNRMLPPDIRVLAWAPVPEDFSAR
YHCTSRTYKYFFSRGKMDIEKMRQGCKYFEGEHDFRNFCKMDPAKNIQSYDRHILSMTVR
PVDHTQTAHIGDGTDFYEVELKGTAFLWHQVRYMMSVLFLVGQGLEPPETIRDVLDIEKV
PSKPDFPMASDLPLVLYDCEFKDIEWFYSFKASTYDPFPSSLRIYLHYNELWNVQMIRSL
TYQYYLTKVGSFPAVMPDKSAKTILDLVKERESDWSDGAALIPLGAGKETRVNKYKPVLL
RPRCDSDQLKKEKYEVRKKRKLDAQEETQS
Download sequence
Identical sequences I1CE01
RO3T_11391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]