SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for I1CHG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1CHG5
Domain Number 1 Region: 2-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.72e-90
Family Capz beta-1 subunit 0.0000000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1CHG5
Sequence length 269
Comment (tr|I1CHG5|I1CHG5_RHIO9) Uncharacterized protein {ECO:0000313|EMBL:EIE87895.1} KW=Complete proteome; Reference proteome OX=246409 OS=43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar). GN=RO3G_12606 OC=Rhizopodaceae; Rhizopus.
Sequence
MSDQFDCALDLMRRLPPQNVEDNLAKLFELVHPDLADELLSSVDQPLKVKRCSKSGKDYL
VCDYNRDGDSYRSPWSNEYEPELLDGAVPSPSLRKLEIAANEAFDTYREMYYEGGVSSVY
AFDMDDKFAIVVLIKKVSDGTRRMKGAWDSIHVFEVSERGRNAQYQLTSTVMLYMITNNQ
DLGNLNLSGSMTRQVEQDYPVDDPSAHIANVGRMVEDMELKMRNSLQEVYFGKTKDIVND
LRSLGSLAESKKQAQIQKELVGRLMERNK
Download sequence
Identical sequences I1CHG5
RO3T_12605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]