SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I1CHJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I1CHJ8
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 7.06e-31
Family Eukaryotic RPB5 N-terminal domain 0.0004
Further Details:      
 
Domain Number 2 Region: 113-188
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 1.44e-30
Family RPB5 0.0000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I1CHJ8
Sequence length 188
Comment (tr|I1CHJ8|I1CHJ8_RHIO9) Uncharacterized protein {ECO:0000313|EMBL:EIE87928.1} KW=Complete proteome; Reference proteome OX=246409 OS=43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar). GN=RO3G_12639 OC=Rhizopodaceae; Rhizopus.
Sequence
MVHDRGYLVSQSELDMDLESFKRTFAPSGDVDRDQLTFVVQKKDDPTDQLLVFFPKDPSV
GVKPLRVYVERMAQQQIPKGICIYQKSMTSSANKVIQQLPSKHTLESFQENELLVNITHH
VLVPKHEVLTAEEKSTLLQRYRLKETQLPRIQHTDPVARYYGLKRGQVVKILRESETAGR
YVSYRLCI
Download sequence
Identical sequences I1CHJ8
RO3T_12638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]